PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015895107.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 512aa    MW: 55311.9 Da    PI: 6.6204
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015895107.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.11.1e-39153213262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ss
  XP_015895107.1 153 PDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSS 213
                     7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-29150205IPR003851Zinc finger, Dof-type
PfamPF027015.9E-32155211IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.882157211IPR003851Zinc finger, Dof-type
PROSITE patternPS013610159195IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MSESRDPAIK LFGKTIALPL NQQQEVSPDD DTSGIACAIY SDSGFVAVET CSDDDHKLLS  60
SPTTTSREDY TANEGDGQDG DGNKETSVKE LNSDRDDTSD QIAEDSKDPT TSSGISDNPK  120
TPSVERETSS LKTSKNEEQS NTSSPQEKTL KKPDKILPCP RCNSMETKFC YYNNYNVNQP  180
RHFCKNCQRY WTAGGTMRNV PVGAGRRKNK NSSSSHYHHI VMSDALQTAR ANTANGVQHS  240
SLGSNGTVLT FGSDSPLCES MASVLNLAVK TQKYARNGLH RHEQRVMVSS GGGESADDHS  300
SGSSITASNS LERGSKPAIK EHQALPPQVP CFPGPPWPYP WNSTQWTSPV PPPAFCHSGF  360
PVSFYPAPPY WGCTVPGSWN MPCLSSPSST LGYPLPSSGP NSSTLGKHSR DGNILNPASS  420
QKEEPVKENN NSEISVLIPK TLRIDDPSEA AKSSIWATLG IKNEKLNSVN GGGLFKVFQS  480
KGDDKNHVVE TSPVLQANPA ALSRSVSFHE RT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015895107.10.0PREDICTED: cyclic dof factor 1
TrEMBLW9S8B00.0W9S8B0_9R
STRINGPOPTR_0008s08740.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.29e-94cycling DOF factor 2